} } { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1913985}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914033}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914089}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914099}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914143}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914179}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914203}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914245}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914266}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1914379}}]); "event" : "unapproveMessage", "event" : "ProductAnswer", "useSimpleView" : "false", "revokeMode" : "true", { }, "actions" : [ } "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ ] "actions" : [ }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1914379,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "messageViewOptions" : "1111110111111111111110111110100101001101" { { "context" : "", } "action" : "rerender" }, "context" : "", "truncateBodyRetainsHtml" : "false", "context" : "envParam:feedbackData", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "event" : "QuickReply", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); { "actions" : [ }, }, { { "event" : "ProductMessageEdit", LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "event" : "deleteMessage", "actions" : [ SMS, MMS, Telefonat etc) anzeigen lassen. LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'j4PXZ7SxCtWbs7eLKTu7SbMN3emV9Tu3kBMHEhfmrrQ. { } "linkDisabled" : "false" } { } "}); "parameters" : { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "action" : "pulsate" ] } } else { "action" : "pulsate" "context" : "", { Execute whatever should happen when entering the right sequence "actions" : [ { { "actions" : [ } "event" : "editProductMessage", { "initiatorBinding" : true, "action" : "rerender" "context" : "", { ', 'ajax'); { "context" : "", ] { { "action" : "rerender" ] "event" : "ProductAnswer", { { } ] } }); "event" : "addMessageUserEmailSubscription", }, } "event" : "approveMessage", "initiatorBinding" : true, { "action" : "rerender" }, LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_69b8bcc783c4fb","nodesModel":{"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Archiv_CallYa|forum-board":{"title":"Board-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_CallYa","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_69b8bcc783c4fb_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); Ich nutze aber "Smartphone Special" und damit zwangsweise die klassische App. "event" : "addThreadUserEmailSubscription", } }); ] LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_69b8bcc81e617f', 'disableAutoComplete', '#ajaxfeedback_69b8bcc783c4fb_0', 'LITHIUM:ajaxError', {}, 'eBZGoZp6c9JvOHZNFKcbhxTW9N_PSffBryjf4FVAX7k. } "event" : "ProductAnswerComment", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ // Oops, not the right sequence, lets restart from the top. "truncateBodyRetainsHtml" : "false", "eventActions" : [ "action" : "rerender" } "actions" : [ "initiatorBinding" : true, "actions" : [ "parameters" : { "action" : "rerender" } } { }); } }, ] "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); { "actions" : [ "action" : "rerender" "event" : "ProductMessageEdit", LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); }, } "context" : "", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'bxQL7zg1LzSb6jHVchYf-fpyjFzlo20MDfAdqYdcyTY. "action" : "pulsate" { }); { "actions" : [ "event" : "MessagesWidgetCommentForm", { ] { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", { }, }, }, "event" : "addMessageUserEmailSubscription", LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); }, "action" : "rerender" "context" : "", }, ] } LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "useTruncatedSubject" : "true", } }, "event" : "markAsSpamWithoutRedirect", } }); $(document).ready(function(){ "context" : "", { "action" : "rerender" { "actions" : [ "event" : "markAsSpamWithoutRedirect", "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "displayStyle" : "horizontal", "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "action" : "pulsate" "actions" : [ "context" : "", "action" : "pulsate" "actions" : [ }, "useSubjectIcons" : "true", "action" : "rerender" })(LITHIUM.jQuery); "entity" : "1914245", "action" : "rerender" "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] ', 'ajax'); "actions" : [ "activecastFullscreen" : false, "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" "action" : "rerender" "event" : "addMessageUserEmailSubscription", "event" : "removeThreadUserEmailSubscription", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1914179,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ { "event" : "expandMessage", "action" : "rerender" "context" : "envParam:quiltName", "useSubjectIcons" : "true", } { }, { lithstudio: [], }); ', 'ajax'); "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "MessagesWidgetAnswerForm", "actions" : [ Bist du sicher, dass du fortfahren möchtest? "action" : "pulsate" ] "useSubjectIcons" : "true", "forceSearchRequestParameterForBlurbBuilder" : "false", { ;(function($) { "useSubjectIcons" : "true", "useTruncatedSubject" : "true", { { "action" : "rerender" ', 'ajax'); }, ] "action" : "rerender" }, "displaySubject" : "true", "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport.useTickets = false; "selector" : "#kudosButtonV2_6", }, "actions" : [ { "context" : "envParam:quiltName,message", "actions" : [ ] "action" : "pulsate" "initiatorDataMatcher" : "data-lia-message-uid" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", })(LITHIUM.jQuery); // Pull in global jQuery reference { LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); "action" : "pulsate" ], }, "actions" : [ { }, { "event" : "MessagesWidgetEditCommentForm", } "displaySubject" : "true", "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "context" : "", "context" : "envParam:entity", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914203 .lia-rating-control-passive', '#form_5'); } "disableKudosForAnonUser" : "false", }, } { "messageViewOptions" : "1111110111111111111110111110100101001101" } } "useCountToKudo" : "false", "action" : "rerender" "context" : "", "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" } } ], "eventActions" : [ "actions" : [ } "event" : "MessagesWidgetMessageEdit", if ( neededkeys[count] == key ) { "linkDisabled" : "false" LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "useSubjectIcons" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] { "componentId" : "forums.widget.message-view", "actions" : [ "context" : "", "actions" : [ "event" : "removeMessageUserEmailSubscription", }, } "actions" : [ ] "forceSearchRequestParameterForBlurbBuilder" : "false", "dialogKey" : "dialogKey" { "disallowZeroCount" : "false", } } "event" : "QuickReply", $('#node-menu li.active').children('ul').show(); ] "initiatorBinding" : true, "context" : "", }, "event" : "approveMessage", }, "event" : "AcceptSolutionAction", } "action" : "rerender" { { ] ] "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", } LITHIUM.AjaxSupport.ComponentEvents.set({ } else { "linkDisabled" : "false" { } } } "context" : "", ] $(this).next().toggle(); "action" : "rerender" "actions" : [ } "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914266 .lia-rating-control-passive', '#form_7'); "action" : "pulsate" { Mit dem CallYa Digital bekommst Du digitalen Service über unsere MeinVodafone-App. }, { { { } }, "actions" : [ "useSimpleView" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", // enable redirect to login page when "logmein" is typed into the void =) }, { { LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" { ] "context" : "", "action" : "rerender" ] "action" : "rerender" { { "context" : "", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "action" : "rerender" } "event" : "addMessageUserEmailSubscription", }, "action" : "rerender" { "actions" : [ } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1914099 .lia-rating-control-passive', '#form_2');