"event" : "kudoEntity", "event" : "MessagesWidgetEditCommentForm", }, { "includeRepliesModerationState" : "false", } var clickHandler = function(event) { })(LITHIUM.jQuery); // Pull in global jQuery reference "disallowZeroCount" : "false", "action" : "rerender" { "initiatorBinding" : true, "action" : "rerender" "context" : "", }, { "useSimpleView" : "false", { //$('#lia-body').addClass('lia-window-scroll'); "message" : "2164482", ], "event" : "approveMessage", }, "componentId" : "kudos.widget.button", "truncateBody" : "true", "event" : "RevokeSolutionAction", ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "ProductMessageEdit", "context" : "", disableInput(pagerId); }, "truncateBodyRetainsHtml" : "false", "actions" : [ "context" : "envParam:entity", logmein: [76, 79, 71, 77, 69, 73, 78], "actions" : [ } document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); { }, "context" : "", { "action" : "rerender" "showCountOnly" : "false", "action" : "rerender" LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "eventActions" : [ "action" : "rerender" "revokeMode" : "true", "context" : "envParam:quiltName,expandedQuiltName", { ', 'ajax'); "event" : "ProductMessageEdit", "initiatorDataMatcher" : "data-lia-message-uid" return; } { } "useSimpleView" : "false", { ] LITHIUM.Dialog.options['-132243386'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "actions" : [ { return false; ;(function($) { }, "revokeMode" : "true", "action" : "rerender" { { // Reset the conditions so that someone can do it all again. ] "actions" : [ }, "action" : "pulsate" "actions" : [ disableInput(pagerId); "truncateBody" : "true", "context" : "envParam:selectedMessage", { } }, "showCountOnly" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "ProductAnswerComment", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); ] ] "context" : "", }, { "action" : "rerender" AVM Fritz!Box 6591 Cable WLAN AC + N Router - 20002857 - 353277313849 "disableKudosForAnonUser" : "false", } { } }, LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); ] "actions" : [ ] { "event" : "editProductMessage", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'IkYJlj2IP_iTYBWQrKazs9aAz5WLN33cXYX2GqLbyII. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/115423/page/4","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vYb8uuuNgW0WDdnKf89H4-GVkXdsYvFOtVRZvEVfs9o. }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "truncateBody" : "true", "displaySubject" : "true", } { "quiltName" : "ForumMessage", } "action" : "pulsate" "disableKudosForAnonUser" : "false", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "initiatorBinding" : true, "action" : "addClassName" LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "message" : "2164354", "event" : "unapproveMessage", ], "actions" : [ { "action" : "pulsate" { { { "parameters" : { ], LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2165196,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "showCountOnly" : "false", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "actions" : [ "event" : "ProductMessageEdit", } "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "parameters" : { ] "event" : "ProductAnswer", }, ], LITHIUM.Dialog.options['-1164519084'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "messageViewOptions" : "1111110111111111111110111110100101001101" window.location.replace('/t5/user/userloginpage'); "event" : "AcceptSolutionAction", "action" : "rerender" "actions" : [ "event" : "MessagesWidgetCommentForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/115423/page/4","ajaxErrorEventName":"LITHIUM:ajaxError","token":"73FjvC434duOOG6TcXJzWoLjmC9zUWuxeRwIdBxBIbg. "message" : "2166094", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "; { }, { "activecastFullscreen" : false, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] }, "event" : "addMessageUserEmailSubscription", }, { { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswer", "initiatorBinding" : true, "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2164298,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" } { } { "truncateBodyRetainsHtml" : "false", return false; "actions" : [ } function setWarning(pagerId) { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "revokeMode" : "true", "actions" : [ "useSubjectIcons" : "true", } { }); { "context" : "lia-deleted-state", "action" : "rerender" var ctaHTML = '. "entity" : "2164439", "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:quiltName,message", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", ], "action" : "rerender" { "context" : "envParam:feedbackData", }, ] "actions" : [ "event" : "MessagesWidgetAnswerForm", } "actions" : [ // Oops, not the right sequence, lets restart from the top. ] { } "event" : "ProductMessageEdit", { "action" : "rerender" "context" : "", { LITHIUM.StarRating('#any_9', false, 1, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-message-uid" "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); return true; "action" : "rerender" { { "action" : "rerender" } }); "event" : "MessagesWidgetCommentForm", Folgende DECT-Geräte können Sie gleichzeitig an der FRITZ!Box betreiben: • bis zu 6 DECT-Schnurlostelefone • bis zu 10 schaltbare Steckdosen FRITZ!DECT 200/210 • bis zu 12 Heizkörperregler FRITZ!DECT 301/300/Comet DECT • bis zu 10 Taster FRITZ!DECT 400 • b "context" : "", } }, { "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'ksjgsmeTj9puz4elmkYfq1-9FkcICL8NTD_71QH6J2c. { "event" : "expandMessage", "event" : "ProductAnswerComment", } "actions" : [ "event" : "deleteMessage", "parameters" : { "action" : "rerender" ] "event" : "MessagesWidgetEditAnswerForm", { "event" : "removeThreadUserEmailSubscription", "actions" : [ { "forceSearchRequestParameterForBlurbBuilder" : "false", o.innerHTML = ""; "action" : "pulsate" "includeRepliesModerationState" : "false", B. genaue Beschreibung etwaiger Fehler oder Mängel im Angebot des Verkäufers. ] "closeImageIconURL" : "https://forum.vodafone.de/skins/images/BF72DBD1E1C060C7CF1DE11B5EED1673/responsive_peak/images/button_dialog_close.svg", }, { { ] "initiatorBinding" : true, "action" : "rerender" "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", "event" : "removeThreadUserEmailSubscription", "displayStyle" : "horizontal", { // --> } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { "includeRepliesModerationState" : "false", { "kudosable" : "true", "event" : "addMessageUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); ', 'ajax'); }, AVM Content. ] "selector" : "#kudosButtonV2_5", LITHIUM.AjaxSupport.ComponentEvents.set({ { Bist du sicher, dass du fortfahren möchtest? "actions" : [ Dieser Artikel wird über das Programm zum weltweiten Versand verschickt und mit einer internationalen Sendungsnummer versehen. ] "eventActions" : [ $(document).ready(function(){ } "event" : "MessagesWidgetCommentForm", { { { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", ] }, { "parameters" : { } "eventActions" : [ "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", AVM FRITZ!Box 6591 Fritzbox Cable Kabel Deutschland Vodafone Branding DOCSIS 3.1. "eventActions" : [ LITHIUM.AjaxSupport.useTickets = false; "action" : "rerender" "componentId" : "kudos.widget.button", } }, "disableKudosForAnonUser" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "actions" : [ } "action" : "rerender" { "entity" : "2164298", "displaySubject" : "true", "context" : "", "kudosLinksDisabled" : "false", { $(document).ready(function(){ "event" : "markAsSpamWithoutRedirect", "action" : "rerender" } "initiatorBinding" : true, "context" : "envParam:quiltName", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Internet-Endgeraete/thread-id/115423/page/4","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I9OXD50cSIAIPkMoQeBaX4NvuB45ltbP5uNDTwTnzA0. { "actions" : [ "initiatorBinding" : true, "action" : "rerender" "event" : "editProductMessage", "}); { "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); } //var height = $(window).scrollTop(); "kudosLinksDisabled" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'ArLI3rbRVUsLsbYZ-3sODw0YOtVCI7Bkl49cp8IwLQI. }, "action" : "rerender" { }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_39","feedbackSelector":".InfoMessage"}); ] } }, "entity" : "2176713", "context" : "", "event" : "RevokeSolutionAction", } } { { "useSubjectIcons" : "true", }); "quiltName" : "ForumMessage", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2165592 .lia-rating-control-passive', '#form_6'); LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. })(LITHIUM.jQuery); ] "displaySubject" : "true", "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" } "context" : "envParam:entity", { "action" : "rerender" "actions" : [ }, "event" : "addThreadUserEmailSubscription", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_25ba306eaa7243_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Internet-Endgeraete/thread-id/115423/page/4&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } { "linkDisabled" : "false" }, $(document).ready(function(){ "event" : "AcceptSolutionAction", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); } "context" : "envParam:quiltName", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ;(function($) { { Started by Klaus. ] } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,message", "actions" : [ "action" : "rerender" LITHIUM.Dialog.options['-789317020'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "kudosLinksDisabled" : "false", ], "context" : "", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "action" : "rerender" { "actions" : [ } "actions" : [ } "context" : "envParam:feedbackData", "event" : "MessagesWidgetAnswerForm", ] ] "context" : "lia-deleted-state", "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "event" : "expandMessage", { }, "defaultAriaLabel" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); })(LITHIUM.jQuery); "context" : "", "quiltName" : "ForumMessage", ', 'ajax'); "context" : "envParam:selectedMessage", "action" : "pulsate" { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] }, "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ { "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Fm8Jxzdaw3PG93mAsYhLcSDKTJqLR_bWzgHxbIWmkFk. "disableLabelLinks" : "false", LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, ] }, .attr('aria-expanded','true') LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "context" : "", { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "", { $(document).ready(function(){ "actions" : [ ] "event" : "removeThreadUserEmailSubscription", "parameters" : { }); } }); } { ;(function($) { "context" : "", "action" : "rerender" { "includeRepliesModerationState" : "false", { }); "actions" : [ "action" : "pulsate" "context" : "lia-deleted-state", FRITZ!Box. ] if ( Number(val) % 1 !== 0 || (String(val).indexOf(".") { } })(LITHIUM.jQuery); // Pull in global jQuery reference "event" : "deleteMessage", $(document).ready(function(){ "event" : "QuickReply", "event" : "QuickReply", { }); } LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "actions" : [ ] ] LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] "actions" : [ "disableKudosForAnonUser" : "false", }, } } var o = document.getElementById("custom_board_pagination_warning" + pagerId); "selector" : "#kudosButtonV2_7", "context" : "envParam:quiltName,expandedQuiltName", } LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2176713 .lia-rating-control-passive', '#form_8'); { }, LITHIUM.Dialog.options['-412324316'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; Typical functionality of … { { { }, "event" : "expandMessage", if (doChecks(pagerId, val)) LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2176713 .lia-rating-control-passive', '#form_8'); "displaySubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "envParam:selectedMessage", }, o.innerHTML = "Page number can\'t exceed 5. { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "showCountOnly" : "false", } "context" : "envParam:quiltName", if ( watching ) { { "linkDisabled" : "false" { } return; "parameters" : { if ( watching ) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); var expireDate = new Date(); } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "actions" : [ } } "parameters" : { "context" : "envParam:quiltName,expandedQuiltName", "event" : "MessagesWidgetMessageEdit", "context" : "envParam:entity", "event" : "deleteMessage", }, "useSimpleView" : "false",